Lineage for d1dlhb2 (1dlh B:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938377Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2938402Domain d1dlhb2: 1dlh B:3-92 [38172]
    Other proteins in same PDB: d1dlha1, d1dlha2, d1dlhb1, d1dlhd1, d1dlhd2, d1dlhe1
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1dlhb2

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
PDB Compounds: (B:) class II histocompatibility antigen (hla-dr1) (beta chain)

SCOPe Domain Sequences for d1dlhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1dlhb2:

Click to download the PDB-style file with coordinates for d1dlhb2.
(The format of our PDB-style files is described here.)

Timeline for d1dlhb2: