Lineage for d1av4_2 (1av4 9-96)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30987Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 30988Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 30989Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 30990Species Arthrobacter globiformis [TaxId:1665] [54421] (3 PDB entries)
  8. 30991Domain d1av4_2: 1av4 9-96 [38049]
    Other proteins in same PDB: d1av4_1

Details for d1av4_2

PDB Entry: 1av4 (more details), 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone

SCOP Domain Sequences for d1av4_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av4_2 d.17.2.1 (9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d1av4_2:

Click to download the PDB-style file with coordinates for d1av4_2.
(The format of our PDB-style files is described here.)

Timeline for d1av4_2: