Lineage for d1av4a2 (1av4 A:9-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2935963Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2936058Domain d1av4a2: 1av4 A:9-96 [38049]
    Other proteins in same PDB: d1av4a1
    complexed with cu

Details for d1av4a2

PDB Entry: 1av4 (more details), 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone
PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d1av4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av4a2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d1av4a2:

Click to download the PDB-style file with coordinates for d1av4a2.
(The format of our PDB-style files is described here.)

Timeline for d1av4a2: