Lineage for d1gnd_2 (1gnd 292-388)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) 
Family d.16.1.6: Guanine nucleotide dissosiation inhibitor, GDI [54399] (1 protein) Protein Guanine nucleotide dissosiation inhibitor, GDI [54400] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54401] (2 PDB entries) 
Domain d1gnd_2: 1gnd 292-388 [37987]
Other proteins in same PDB: d1gnd_1
Details for d1gnd_2
PDB Entry: 1gnd (more details), 1.81 Å
PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform
SCOP Domain Sequences for d1gnd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnd_2 d.16.1.6 (292-388) Guanine nucleotide dissosiation inhibitor, GDI {Cow (Bos taurus)}
rkagqviriicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyia
iasttvettdpekevepalellepidqkfvaisdlye
SCOP Domain Coordinates for d1gnd_2:
Click to download the PDB-style file with coordinates for d1gnd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gnd_2:
- d1gnd_2 appears in SCOP 1.57
- d1gnd_2 appears in the current release, SCOPe 2.08, called d1gnda2
View in 3D
