Lineage for d1gnd_1 (1gnd 1-291,389-430)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.3: Guanine nucleotide dissosiation inhibitor, GDI [51931] (1 protein) Protein Guanine nucleotide dissosiation inhibitor, GDI [51932] (1 species) Species Cow (Bos taurus) [TaxId:9913] [51933] (2 PDB entries) 
Domain d1gnd_1: 1gnd 1-291,389-430 [30423]
Other proteins in same PDB: d1gnd_2
Details for d1gnd_1
PDB Entry: 1gnd (more details), 1.81 Å
PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform
SCOP Domain Sequences for d1gnd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnd_1 c.3.1.3 (1-291,389-430) Guanine nucleotide dissosiation inhibitor, GDI {Cow (Bos taurus)}
mdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfqlle
gppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiykvp
stetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlgqd
vidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgfar
lsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgses
qvfcscsydatthfettcndikdiykrmagsafd
SCOP Domain Coordinates for d1gnd_1:
Click to download the PDB-style file with coordinates for d1gnd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gnd_1:
- d1gnd_1 appears in SCOP 1.57
- d1gnd_1 appears in the current release, SCOPe 2.08, called d1gnda1
View in 3D
