SCOPe 2.08: Domain d6p04b2: 6p04 B:126-253

Lineage for d6p04b2 (6p04 B:126-253)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families)

5. Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins)
   N-terminal catalytic domain is followed by an all-alpha domain
   automatically mapped to Pfam PF07827

6. Protein automated matches [379001] (3 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [379552] (4 PDB entries)

8. Domain d6p04b2: 6p04 B:126-253 [379586]
   Other proteins in same PDB: d6p04a1, d6p04b1
   automated match to d1kana1
   protein/DNA complex; complexed with mg, nmy; mutant

Details for d6p04b2

PDB Entry: 6p04, 2.3 Å

PDB Description: binary structure of the e52d mutant of ant-4'' with neomycin

PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6p04b2:

Sequence; same for both SEQRES and ATOM records:

>d6p04b2 a.24.16.1 (B:126-253) automated matches {Bacillus sp. [TaxId: 1409]}
veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

Timeline for d6p04b2:

• d6p04b2 first appeared in SCOPe 2.07