Lineage for d6p04a1 (6p04 A:2-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006868Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 3006875Protein automated matches [378998] (3 species)
    not a true protein
  7. 3006876Species Bacillus sp. [TaxId:1409] [379550] (4 PDB entries)
  8. 3006881Domain d6p04a1: 6p04 A:2-125 [379559]
    Other proteins in same PDB: d6p04a2, d6p04b2
    automated match to d1knya2
    protein/DNA complex; complexed with mg, nmy; mutant

Details for d6p04a1

PDB Entry: 6p04 (more details), 2.3 Å

PDB Description: binary structure of the e52d mutant of ant-4'' with neomycin
PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6p04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p04a1 d.218.1.1 (A:2-125) automated matches {Bacillus sp. [TaxId: 1409]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

SCOPe Domain Coordinates for d6p04a1:

Click to download the PDB-style file with coordinates for d6p04a1.
(The format of our PDB-style files is described here.)

Timeline for d6p04a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6p04a2