SCOPe 2.08: Domain d6p04b1: 6p04 B:2-125

Lineage for d6p04b1 (6p04 B:2-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [379550] (4 PDB entries)

8. Domain d6p04b1: 6p04 B:2-125 [379585]
   Other proteins in same PDB: d6p04a2, d6p04b2
   automated match to d1knya2
   protein/DNA complex; complexed with mg, nmy; mutant

Details for d6p04b1

PDB Entry: 6p04, 2.3 Å

PDB Description: binary structure of the e52d mutant of ant-4'' with neomycin

PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6p04b1:

Sequence; same for both SEQRES and ATOM records:

>d6p04b1 d.218.1.1 (B:2-125) automated matches {Bacillus sp. [TaxId: 1409]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

Timeline for d6p04b1:

• d6p04b1 first appeared in SCOPe 2.07