Lineage for d6mxzc1 (6mxz C:1484-1537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784606Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
    protein duplication: contains two Tudor domains in tandem
  7. 2784607Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2784647Domain d6mxzc1: 6mxz C:1484-1537 [377449]
    Other proteins in same PDB: d6mxza2, d6mxzb2, d6mxzc2, d6mxzd2, d6mxze2, d6mxze3, d6mxzf2, d6mxzg2, d6mxzg3, d6mxzh2, d6mxzi2, d6mxzj2
    automated match to d2lvma1
    protein/DNA complex; complexed with fmt, k6s

Details for d6mxzc1

PDB Entry: 6mxz (more details), 2.5 Å

PDB Description: structure of 53bp1 tudor domains in complex with small molecule unc3474
PDB Compounds: (C:) TP53-binding protein 1

SCOPe Domain Sequences for d6mxzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mxzc1 b.34.9.1 (C:1484-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d6mxzc1:

Click to download the PDB-style file with coordinates for d6mxzc1.
(The format of our PDB-style files is described here.)

Timeline for d6mxzc1: