Lineage for d2lvma1 (2lvm A:1484-1537)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
    protein duplication: contains two Tudor domains in tandem
  7. Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. Domain d2lvma1: 2lvm A:1484-1537 [243008]
    Other proteins in same PDB: d2lvma2, d2lvma3
    automated match to d1ssfa1

Details for d2lvma1

PDB Entry: 2lvm (more details)

PDB Description: Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide
PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d2lvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lvma1 b.34.9.1 (A:1484-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d2lvma1 are not available.

Timeline for d2lvma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lvma2, d2lvma3