SCOPe 2.08: Domain d6mxzh2: 6mxz H:1538-1602

Lineage for d6mxzh2 (6mxz H:1538-1602)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6mxzh2: 6mxz H:1538-1602 [377394]
   Other proteins in same PDB: d6mxza1, d6mxzb1, d6mxzc1, d6mxzd1, d6mxze1, d6mxze3, d6mxzf1, d6mxzg1, d6mxzg3, d6mxzh1, d6mxzi1, d6mxzj1
   automated match to d1ssfa2
   protein/DNA complex; complexed with fmt, k6s

Details for d6mxzh2

PDB Entry: 6mxz, 2.5 Å

PDB Description: structure of 53bp1 tudor domains in complex with small molecule unc3474

PDB Compounds: (H:) TP53-binding protein 1

SCOPe Domain Sequences for d6mxzh2:

Sequence; same for both SEQRES and ATOM records:

>d6mxzh2 b.34.9.1 (H:1538-1602) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

Timeline for d6mxzh2:

• d6mxzh2 first appeared in SCOPe 2.07