Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species) protein duplication: contains two Tudor domains in tandem |
Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
Domain d6mxzh2: 6mxz H:1538-1602 [377394] Other proteins in same PDB: d6mxza1, d6mxzb1, d6mxzc1, d6mxzd1, d6mxze1, d6mxze3, d6mxzf1, d6mxzg1, d6mxzg3, d6mxzh1, d6mxzi1, d6mxzj1 automated match to d1ssfa2 protein/DNA complex; complexed with fmt, k6s |
PDB Entry: 6mxz (more details), 2.5 Å
SCOPe Domain Sequences for d6mxzh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mxzh2 b.34.9.1 (H:1538-1602) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr eqygl
Timeline for d6mxzh2: