SCOP 1.55: Domain d1bmld3: 1bml D:285-372

Lineage for d1bmld3 (1bml D:285-372)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family)

5. Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)

6. Protein Streptokinase [54332] (1 species)

7. Species Streptococcus equisimilis [TaxId:119602] [54333] (3 PDB entries)

8. Domain d1bmld3: 1bml D:285-372 [37734]
   Other proteins in same PDB: d1bmla_, d1bmlb_

Details for d1bmld3

PDB Entry: 1bml, 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase

PDB Compounds: (D:) Streptokinase

SCOP Domain Sequences for d1bmld3:

Sequence; same for both SEQRES and ATOM records:

>d1bmld3 d.15.5.1 (D:285-372) Streptokinase {Streptococcus equisimilis}
dpfdrshlklftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafg
imdytltgkvednhddtnriitvymgkr

Timeline for d1bmld3:

• d1bmld3 appears in SCOP 1.57
  
• d1bmld3 appears in the current release, SCOPe 2.08