Lineage for d1bmlc3 (1bml C:285-372)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30603Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
  5. 30604Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)
  6. 30617Protein Streptokinase [54332] (1 species)
  7. 30618Species Streptococcus equisimilis [TaxId:119602] [54333] (3 PDB entries)
  8. 30629Domain d1bmlc3: 1bml C:285-372 [37731]
    Other proteins in same PDB: d1bmla_, d1bmlb_

Details for d1bmlc3

PDB Entry: 1bml (more details), 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase
PDB Compounds: (C:) Streptokinase

SCOP Domain Sequences for d1bmlc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmlc3 d.15.5.1 (C:285-372) Streptokinase {Streptococcus equisimilis}
dpfdrshlklftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafg
imdytltgkvednhddtnriitvymgkr

SCOP Domain Coordinates for d1bmlc3:

Click to download the PDB-style file with coordinates for d1bmlc3.
(The format of our PDB-style files is described here.)

Timeline for d1bmlc3: