Lineage for d6d3qe2 (6d3q E:140-431)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836770Protein Enolase [51606] (11 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2836802Species Escherichia coli [TaxId:562] [69396] (3 PDB entries)
  8. 2836815Domain d6d3qe2: 6d3q E:140-431 [377215]
    Other proteins in same PDB: d6d3qa1, d6d3qa3, d6d3qb1, d6d3qb3, d6d3qc1, d6d3qc3, d6d3qd1, d6d3qd3, d6d3qe1, d6d3qe3, d6d3qf1, d6d3qf3
    automated match to d2fymc1
    complexed with 4ng, gol, mg, so4

Details for d6d3qe2

PDB Entry: 6d3q (more details), 2.24 Å

PDB Description: crystal structure of escherichia coli enolase complexed with a natural inhibitor sf2312.
PDB Compounds: (E:) enolase

SCOPe Domain Sequences for d6d3qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d3qe2 c.1.11.1 (E:140-431) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa

SCOPe Domain Coordinates for d6d3qe2:

Click to download the PDB-style file with coordinates for d6d3qe2.
(The format of our PDB-style files is described here.)

Timeline for d6d3qe2: