Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
Species Escherichia coli [TaxId:562] [69396] (3 PDB entries) |
Domain d6d3qe2: 6d3q E:140-431 [377215] Other proteins in same PDB: d6d3qa1, d6d3qa3, d6d3qb1, d6d3qb3, d6d3qc1, d6d3qc3, d6d3qd1, d6d3qd3, d6d3qe1, d6d3qe3, d6d3qf1, d6d3qf3 automated match to d2fymc1 complexed with 4ng, gol, mg, so4 |
PDB Entry: 6d3q (more details), 2.24 Å
SCOPe Domain Sequences for d6d3qe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d3qe2 c.1.11.1 (E:140-431) Enolase {Escherichia coli [TaxId: 562]} pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa
Timeline for d6d3qe2: