Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Escherichia coli [TaxId:562] [359490] (4 PDB entries) |
Domain d6d3qa1: 6d3q A:0-139 [377219] Other proteins in same PDB: d6d3qa2, d6d3qa3, d6d3qb2, d6d3qb3, d6d3qc2, d6d3qc3, d6d3qd2, d6d3qd3, d6d3qe2, d6d3qe3, d6d3qf2, d6d3qf3 automated match to d2fyma2 complexed with 4ng, gol, mg, so4 |
PDB Entry: 6d3q (more details), 2.24 Å
SCOPe Domain Sequences for d6d3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d3qa1 d.54.1.0 (A:0-139) automated matches {Escherichia coli [TaxId: 562]} mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak aaaaakgmplyehiaelngt
Timeline for d6d3qa1: