Lineage for d6d3qe1 (6d3q E:0-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948215Species Escherichia coli [TaxId:562] [359490] (4 PDB entries)
  8. 2948232Domain d6d3qe1: 6d3q E:0-139 [377212]
    Other proteins in same PDB: d6d3qa2, d6d3qa3, d6d3qb2, d6d3qb3, d6d3qc2, d6d3qc3, d6d3qd2, d6d3qd3, d6d3qe2, d6d3qe3, d6d3qf2, d6d3qf3
    automated match to d2fyma2
    complexed with 4ng, gol, mg, so4

Details for d6d3qe1

PDB Entry: 6d3q (more details), 2.24 Å

PDB Description: crystal structure of escherichia coli enolase complexed with a natural inhibitor sf2312.
PDB Compounds: (E:) enolase

SCOPe Domain Sequences for d6d3qe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d3qe1 d.54.1.0 (E:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d6d3qe1:

Click to download the PDB-style file with coordinates for d6d3qe1.
(The format of our PDB-style files is described here.)

Timeline for d6d3qe1: