PDB entry 6d3q

View 6d3q on RCSB PDB site
Description: Crystal structure of Escherichia coli enolase complexed with a natural inhibitor SF2312.
Class: LYASE/LYASE inhibitor
Keywords: Enolase, complex, natural inhibitor, SF2312, LYASE, LYASE-LYASE inhibitor complex
Deposited on 2018-04-16, released 2019-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-End)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qa1, d6d3qa2, d6d3qa3
  • Chain 'B':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-End)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qb1, d6d3qb2, d6d3qb3
  • Chain 'C':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-438)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qc1, d6d3qc2, d6d3qc3
  • Chain 'D':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-438)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qd1, d6d3qd2, d6d3qd3
  • Chain 'E':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-438)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qe1, d6d3qe2, d6d3qe3
  • Chain 'F':
    Compound: enolase
    Species: Escherichia coli [TaxId:562]
    Gene: ENO
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLA0 (7-438)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d6d3qf1, d6d3qf2, d6d3qf3
  • Heterogens: 4NG, MG, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3qA (A:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3qA (A:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3qB (B:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3qB (B:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d3qC (C:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3qC (C:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnftseefthfleeltkqypivsiedglde
    sdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaa
    ikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieea
    lgekapyngrkeikgqa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d3qD (D:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d3qE (E:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d3qF (F:)
    qqmgrgsmskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrd
    gdksrflgkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganaila
    vslanakaaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqp
    vgaktvkeairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaa
    gyelgkditlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgl
    desdwdgfayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetl
    aaikmakdagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirie
    ealgekapyngrkeikgqa