![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (16 species) |
![]() | Species Parsley (Petroselinum crispum) [TaxId:4043] [54303] (1 PDB entry) |
![]() | Domain d1pfd__: 1pfd - [37677] complexed with fes |
PDB Entry: 1pfd (more details)
SCOP Domain Sequences for d1pfd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Parsley (Petroselinum crispum)} atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd qsflddeqmdagyvltchayptsdvviethkeeeiv
Timeline for d1pfd__: