PDB entry 1pfd

View 1pfd on RCSB PDB site
Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Deposited on 1998-05-05, released 1999-05-11
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1pfd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfd_ (-)
    atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
    qsflddeqmdagyvltchayptsdvviethkeeeiv