Lineage for d1pfd__ (1pfd -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325573Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 325574Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 325575Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 325612Species Parsley (Petroselinum crispum) [TaxId:4043] [54303] (1 PDB entry)
  8. 325613Domain d1pfd__: 1pfd - [37677]
    complexed with fes

Details for d1pfd__

PDB Entry: 1pfd (more details)

PDB Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures

SCOP Domain Sequences for d1pfd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Parsley (Petroselinum crispum)}
atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
qsflddeqmdagyvltchayptsdvviethkeeeiv

SCOP Domain Coordinates for d1pfd__:

Click to download the PDB-style file with coordinates for d1pfd__.
(The format of our PDB-style files is described here.)

Timeline for d1pfd__: