Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (11 species) |
Species Cyanobacterium (Aphanothece sacrum) [TaxId:1122] [54297] (1 PDB entry) |
Domain d1fxib_: 1fxi B: [37665] |
PDB Entry: 1fxi (more details), 2.2 Å
SCOP Domain Sequences for d1fxib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxib_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Cyanobacterium (Aphanothece sacrum)} asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded qsfldddqiqagyiltcvayptgdcviethkeealy
Timeline for d1fxib_: