Lineage for d1fxic_ (1fxi C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30503Protein 2Fe-2S ferredoxin [54294] (11 species)
  7. 30525Species Cyanobacterium (Aphanothece sacrum) [TaxId:1122] [54297] (1 PDB entry)
  8. 30528Domain d1fxic_: 1fxi C: [37666]

Details for d1fxic_

PDB Entry: 1fxi (more details), 2.2 Å

PDB Description: structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution

SCOP Domain Sequences for d1fxic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxic_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Cyanobacterium (Aphanothece sacrum)}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

SCOP Domain Coordinates for d1fxic_:

Click to download the PDB-style file with coordinates for d1fxic_.
(The format of our PDB-style files is described here.)

Timeline for d1fxic_: