Lineage for d6jjpc_ (6jjp C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741861Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2741862Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)
  8. 2741878Domain d6jjpc_: 6jjp C: [376362]
    Other proteins in same PDB: d6jjpa_, d6jjpb1, d6jjpb2, d6jjpd_, d6jjpe1, d6jjpe2
    automated match to d5wt9g_
    complexed with nag

Details for d6jjpc_

PDB Entry: 6jjp (more details), 2.9 Å

PDB Description: crystal structure of fab of a pd-1 monoclonal antibody mw11-h317 in complex with pd-1
PDB Compounds: (C:) Programmed cell death protein 1

SCOPe Domain Sequences for d6jjpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jjpc_ b.1.1.1 (C:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqp
gqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

SCOPe Domain Coordinates for d6jjpc_:

Click to download the PDB-style file with coordinates for d6jjpc_.
(The format of our PDB-style files is described here.)

Timeline for d6jjpc_: