SCOPe 2.08: Domain d6jjpb1: 6jjp B:1-106

Lineage for d6jjpb1 (6jjp B:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6jjpb1: 6jjp B:1-106 [376395]
   Other proteins in same PDB: d6jjpa_, d6jjpb2, d6jjpc_, d6jjpd_, d6jjpe2, d6jjpf_
   automated match to d1dn0a1
   complexed with nag

Details for d6jjpb1

PDB Entry: 6jjp, 2.9 Å

PDB Description: crystal structure of fab of a pd-1 monoclonal antibody mw11-h317 in complex with pd-1

PDB Compounds: (B:) light chain of MW11-h317

SCOPe Domain Sequences for d6jjpb1:

Sequence; same for both SEQRES and ATOM records:

>d6jjpb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasitckasqdvetvvawylqkpgqsprlliywastrhtgvpd
rfsgsgsgtdftlkisrveaedvgvyycqqysrypwtfgqgtklei

Timeline for d6jjpb1:

• d6jjpb1 first appeared in SCOPe 2.07