Lineage for d6jjpe2 (6jjp E:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751347Domain d6jjpe2: 6jjp E:107-213 [376420]
    Other proteins in same PDB: d6jjpa_, d6jjpb1, d6jjpc_, d6jjpd_, d6jjpe1, d6jjpf_
    automated match to d1dn0a2
    complexed with nag

Details for d6jjpe2

PDB Entry: 6jjp (more details), 2.9 Å

PDB Description: crystal structure of fab of a pd-1 monoclonal antibody mw11-h317 in complex with pd-1
PDB Compounds: (E:) light chain of MW11-h317

SCOPe Domain Sequences for d6jjpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jjpe2 b.1.1.2 (E:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6jjpe2:

Click to download the PDB-style file with coordinates for d6jjpe2.
(The format of our PDB-style files is described here.)

Timeline for d6jjpe2: