SCOPe 2.08: Domain d1a5ra1: 1a5r A:1-101

Lineage for d1a5ra1 (1a5r A:1-101)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
   Uniprot Q93068

8. Domain d1a5ra1: 1a5r A:1-101 [37597]
   Other proteins in same PDB: d1a5ra2

Details for d1a5ra1

PDB Entry: 1a5r

PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures

PDB Compounds: (A:) sumo-1

SCOPe Domain Sequences for d1a5ra1:

Sequence; same for both SEQRES and ATOM records:

>d1a5ra1 d.15.1.1 (A:1-101) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

Timeline for d1a5ra1:

• d1a5ra1 first appeared (with stable ids) in SCOP 1.55, called d1a5r__
  
• d1a5ra1 appears in SCOPe 2.07