PDB entry 1a5r

View 1a5r on RCSB PDB site
Description: structure determination of the small ubiquitin-related modifier sumo-1, nmr, 10 structures
Class: targeting protein
Keywords: sumo-1, post-translational protein modification, ubiquitin-like proteins, targeting protein
Deposited on 1998-02-18, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sumo-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a5ra1, d1a5ra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5rA (A:)
    gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
    mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv