Lineage for d1a5ra1 (1a5r A:1-101)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538611Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 2538619Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
    Uniprot Q93068
  8. 2538629Domain d1a5ra1: 1a5r A:1-101 [37597]
    Other proteins in same PDB: d1a5ra2

Details for d1a5ra1

PDB Entry: 1a5r (more details)

PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures
PDB Compounds: (A:) sumo-1

SCOPe Domain Sequences for d1a5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ra1 d.15.1.1 (A:1-101) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

SCOPe Domain Coordinates for d1a5ra1:

Click to download the PDB-style file with coordinates for d1a5ra1.
(The format of our PDB-style files is described here.)

Timeline for d1a5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5ra2