Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries) Uniprot Q93068 |
Domain d1a5ra1: 1a5r A:1-101 [37597] Other proteins in same PDB: d1a5ra2 |
PDB Entry: 1a5r (more details)
SCOPe Domain Sequences for d1a5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ra1 d.15.1.1 (A:1-101) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn slrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
Timeline for d1a5ra1: