![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (5 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (5 proteins) |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54242] (1 PDB entry) |
![]() | Domain d1a5r__: 1a5r - [37597] |
PDB Entry: 1a5r (more details)
SCOP Domain Sequences for d1a5r__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5r__ d.15.1.1 (-) SUMO-1 (smt3 homologue) {Human (Homo sapiens)} gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
Timeline for d1a5r__: