| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
| Domain d6jlmm_: 6jlm M: [375498] Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlm (more details), 2.35 Å
SCOPe Domain Sequences for d6jlmm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlmm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d6jlmm_: