SCOPe 2.08: Domain d6jlmk_: 6jlm K:

Lineage for d6jlmk_ (6jlm K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.1: PsbK-like [161038] (2 proteins)
   Pfam PF02533

6. Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)

8. Domain d6jlmk_: 6jlm K: [375594]
   Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_
   automated match to d5h2fk_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmk_

PDB Entry: 6jlm, 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)

PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d6jlmk_:

Sequence; same for both SEQRES and ATOM records:

>d6jlmk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d6jlmk_:

• d6jlmk_ first appeared in SCOPe 2.07