Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) automatically mapped to Pfam PF02533 |
Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries) |
Domain d6jlmk_: 6jlm K: [375594] Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_ automated match to d5h2fk_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlm (more details), 2.35 Å
SCOPe Domain Sequences for d6jlmk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlmk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d6jlmk_: