SCOPe 2.08: Domain d6jlmv_: 6jlm v:

Lineage for d6jlmv_ (6jlm v:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c550 [100991] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)

8. Domain d6jlmv_: 6jlm v: [375550]
   Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmx_, d6jlmz_
   automated match to d5h2fv_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmv_

PDB Entry: 6jlm, 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)

PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d6jlmv_:

Sequence; same for both SEQRES and ATOM records:

>d6jlmv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

Timeline for d6jlmv_:

• d6jlmv_ first appeared in SCOPe 2.07