Lineage for d1kpf__ (1kpf -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189040Fold d.13: HIT-like [54196] (2 superfamilies)
  4. 189041Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 189042Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 189063Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 189064Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 189065Domain d1kpf__: 1kpf - [37507]

Details for d1kpf__

PDB Entry: 1kpf (more details), 1.5 Å

PDB Description: pkci-substrate analog

SCOP Domain Sequences for d1kpf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpf__ d.13.1.1 (-) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOP Domain Coordinates for d1kpf__:

Click to download the PDB-style file with coordinates for d1kpf__.
(The format of our PDB-style files is described here.)

Timeline for d1kpf__: