Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.13: HIT-like [54196] (1 superfamily) |
Superfamily d.13.1: HIT-like [54197] (2 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) |
Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) |
Domain d1kpf__: 1kpf - [37507] |
PDB Entry: 1kpf (more details), 1.5 Å
SCOP Domain Sequences for d1kpf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpf__ d.13.1.1 (-) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)} dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d1kpf__: