Lineage for d1kpfa_ (1kpf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929793Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 2929794Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 2929795Domain d1kpfa_: 1kpf A: [37507]
    complexed with amp

Details for d1kpfa_

PDB Entry: 1kpf (more details), 1.5 Å

PDB Description: pkci-substrate analog
PDB Compounds: (A:) protein kinase c interacting protein

SCOPe Domain Sequences for d1kpfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]}
dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d1kpfa_:

Click to download the PDB-style file with coordinates for d1kpfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kpfa_: