Lineage for d1kpf__ (1kpf -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.13: HIT-like [54196] (1 superfamily) Superfamily d.13.1: HIT-like [54197] (2 families) 
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) 
Domain d1kpf__: 1kpf - [37507]
Details for d1kpf__
PDB Entry: 1kpf (more details), 1.5 Å
PDB Description: pkci-substrate analog
SCOP Domain Sequences for d1kpf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpf__ d.13.1.1 (-) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
SCOP Domain Coordinates for d1kpf__:
Click to download the PDB-style file with coordinates for d1kpf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kpf__:
- d1kpf__ appears in SCOP 1.57
- d1kpf__ appears in the current release, SCOPe 2.08, called d1kpfa_
View in 3D