Lineage for d1mi2a_ (1mi2 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30107Protein Macrophage inflammatory protein-2 [54152] (1 species)
  7. 30108Species Mouse (Mus musculus) [TaxId:10090] [54153] (1 PDB entry)
  8. 30109Domain d1mi2a_: 1mi2 A: [37455]

Details for d1mi2a_

PDB Entry: 1mi2 (more details)

PDB Description: solution structure of murine macrophage inflammatory protein-2, nmr, 20 structures

SCOP Domain Sequences for d1mi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi2a_ d.9.1.1 (A:) Macrophage inflammatory protein-2 {Mouse (Mus musculus)}
avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
kiiqkilnkgkan

SCOP Domain Coordinates for d1mi2a_:

Click to download the PDB-style file with coordinates for d1mi2a_.
(The format of our PDB-style files is described here.)

Timeline for d1mi2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mi2b_