PDB entry 1mi2

View 1mi2 on RCSB PDB site
Description: solution structure of murine macrophage inflammatory protein-2, nmr, 20 structures
Deposited on 1997-10-24, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-20, with a file datestamp of 2000-01-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mi2a_
  • Chain 'B':
    Domains in SCOP 1.55: d1mi2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mi2A (A:)
avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
kiiqkilnkgkan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mi2B (B:)
avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
kiiqkilnkgkan