SCOPe 2.07: Domain d6r2ua1: 6r2u A:5-183

Lineage for d6r2ua1 (6r2u A:5-183)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries)
   Uniprot P25311 22-294

8. Domain d6r2ua1: 6r2u A:5-183 [374513]
   Other proteins in same PDB: d6r2ua2, d6r2ub2, d6r2uc2, d6r2ud2, d6r2ue2, d6r2uf2
   automated match to d1zaga2
   complexed with 11d, azi, so4

Details for d6r2ua1

PDB Entry: 6r2u, 2.49 Å

PDB Description: zinc-alpha2-glycoprotein with a fluorescent dansyl c 11 fatty acid

PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d6r2ua1:

Sequence; same for both SEQRES and ATOM records:

>d6r2ua1 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

Timeline for d6r2ua1:

• d6r2ua1 is new in SCOPe 2.07-stable
  
• d6r2ua1 appears in the current release, SCOPe 2.08