Lineage for d6r2uc1 (6r2u C:5-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545601Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 2545602Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries)
    Uniprot P25311 22-294
  8. 2545611Domain d6r2uc1: 6r2u C:5-183 [374525]
    Other proteins in same PDB: d6r2ua2, d6r2ub2, d6r2uc2, d6r2ud2, d6r2ue2, d6r2uf2
    automated match to d1zaga2
    complexed with 11d, azi, so4

Details for d6r2uc1

PDB Entry: 6r2u (more details), 2.49 Å

PDB Description: zinc-alpha2-glycoprotein with a fluorescent dansyl c 11 fatty acid
PDB Compounds: (C:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d6r2uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r2uc1 d.19.1.1 (C:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOPe Domain Coordinates for d6r2uc1:

Click to download the PDB-style file with coordinates for d6r2uc1.
(The format of our PDB-style files is described here.)

Timeline for d6r2uc1: