Lineage for d6r2uc2 (6r2u C:184-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361198Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 2361199Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
    Uniprot P25311 22-294
  8. 2361208Domain d6r2uc2: 6r2u C:184-276 [374526]
    Other proteins in same PDB: d6r2ua1, d6r2ub1, d6r2uc1, d6r2ud1, d6r2ue1, d6r2uf1
    automated match to d1t7va1
    complexed with 11d, azi, so4

Details for d6r2uc2

PDB Entry: 6r2u (more details), 2.49 Å

PDB Description: zinc-alpha2-glycoprotein with a fluorescent dansyl c 11 fatty acid
PDB Compounds: (C:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d6r2uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r2uc2 b.1.1.2 (C:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwe

SCOPe Domain Coordinates for d6r2uc2:

Click to download the PDB-style file with coordinates for d6r2uc2.
(The format of our PDB-style files is described here.)

Timeline for d6r2uc2: