SCOPe 2.07: Domain d6r2ua2: 6r2u A:184-276

Lineage for d6r2ua2 (6r2u A:184-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
   Uniprot P25311 22-294

8. Domain d6r2ua2: 6r2u A:184-276 [374514]
   Other proteins in same PDB: d6r2ua1, d6r2ub1, d6r2uc1, d6r2ud1, d6r2ue1, d6r2uf1
   automated match to d1t7va1
   complexed with 11d, azi, so4

Details for d6r2ua2

PDB Entry: 6r2u, 2.49 Å

PDB Description: zinc-alpha2-glycoprotein with a fluorescent dansyl c 11 fatty acid

PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d6r2ua2:

Sequence; same for both SEQRES and ATOM records:

>d6r2ua2 b.1.1.2 (A:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwe

Timeline for d6r2ua2:

• d6r2ua2 is new in SCOPe 2.07-stable
  
• d6r2ua2 appears in the current release, SCOPe 2.08