Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein automated matches [254674] (3 species) not a true protein |
Species Escherichia coli [TaxId:696406] [372362] (1 PDB entry) |
Domain d6oi9b2: 6oi9 B:115-330 [372373] Other proteins in same PDB: d6oi9a1, d6oi9a3, d6oi9b1, d6oi9b3 automated match to d1dv2a3 complexed with edo, mqm |
PDB Entry: 6oi9 (more details), 2.06 Å
SCOPe Domain Sequences for d6oi9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oi9b2 d.142.1.2 (B:115-330) automated matches {Escherichia coli [TaxId: 696406]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d6oi9b2: