SCOPe 2.08: Domain d6oi9a1: 6oi9 A:1-114

Lineage for d6oi9a1 (6oi9 A:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:696406] [372360] (1 PDB entry)

8. Domain d6oi9a1: 6oi9 A:1-114 [372361]
   Other proteins in same PDB: d6oi9a2, d6oi9a3, d6oi9b2, d6oi9b3
   automated match to d3rv3a1
   complexed with edo, mqm

Details for d6oi9a1

PDB Entry: 6oi9, 2.06 Å

PDB Description: crystal structure of e. coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d6oi9a1:

Sequence; same for both SEQRES and ATOM records:

>d6oi9a1 c.30.1.0 (A:1-114) automated matches {Escherichia coli [TaxId: 696406]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d6oi9a1:

• d6oi9a1 first appeared in SCOPe 2.07