Lineage for d6oi9b1 (6oi9 B:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862406Species Escherichia coli [TaxId:696406] [372360] (1 PDB entry)
  8. 2862408Domain d6oi9b1: 6oi9 B:1-114 [372372]
    Other proteins in same PDB: d6oi9a2, d6oi9a3, d6oi9b2, d6oi9b3
    automated match to d3rv3a1
    complexed with edo, mqm

Details for d6oi9b1

PDB Entry: 6oi9 (more details), 2.06 Å

PDB Description: crystal structure of e. coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d6oi9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oi9b1 c.30.1.0 (B:1-114) automated matches {Escherichia coli [TaxId: 696406]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d6oi9b1:

Click to download the PDB-style file with coordinates for d6oi9b1.
(The format of our PDB-style files is described here.)

Timeline for d6oi9b1: