Lineage for d6oi9a2 (6oi9 A:115-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978730Protein automated matches [254674] (3 species)
    not a true protein
  7. 2978735Species Escherichia coli [TaxId:696406] [372362] (1 PDB entry)
  8. 2978736Domain d6oi9a2: 6oi9 A:115-330 [372363]
    Other proteins in same PDB: d6oi9a1, d6oi9a3, d6oi9b1, d6oi9b3
    automated match to d1dv2a3
    complexed with edo, mqm

Details for d6oi9a2

PDB Entry: 6oi9 (more details), 2.06 Å

PDB Description: crystal structure of e. coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d6oi9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oi9a2 d.142.1.2 (A:115-330) automated matches {Escherichia coli [TaxId: 696406]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d6oi9a2:

Click to download the PDB-style file with coordinates for d6oi9a2.
(The format of our PDB-style files is described here.)

Timeline for d6oi9a2: