Lineage for d6oi9a3 (6oi9 A:331-447)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817684Species Escherichia coli [TaxId:696406] [372364] (1 PDB entry)
  8. 2817685Domain d6oi9a3: 6oi9 A:331-447 [372365]
    Other proteins in same PDB: d6oi9a1, d6oi9a2, d6oi9b1, d6oi9b2
    automated match to d2w6za3
    complexed with edo, mqm

Details for d6oi9a3

PDB Entry: 6oi9 (more details), 2.06 Å

PDB Description: crystal structure of e. coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d6oi9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oi9a3 b.84.2.0 (A:331-447) automated matches {Escherichia coli [TaxId: 696406]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

SCOPe Domain Coordinates for d6oi9a3:

Click to download the PDB-style file with coordinates for d6oi9a3.
(The format of our PDB-style files is described here.)

Timeline for d6oi9a3: