![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
![]() | Protein automated matches [254496] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:696406] [372364] (1 PDB entry) |
![]() | Domain d6oi9a3: 6oi9 A:331-447 [372365] Other proteins in same PDB: d6oi9a1, d6oi9a2, d6oi9b1, d6oi9b2 automated match to d2w6za3 complexed with edo, mqm |
PDB Entry: 6oi9 (more details), 2.06 Å
SCOPe Domain Sequences for d6oi9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oi9a3 b.84.2.0 (A:331-447) automated matches {Escherichia coli [TaxId: 696406]} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq
Timeline for d6oi9a3: