SCOPe 2.08: Domain d6oi9a3: 6oi9 A:331-447

Lineage for d6oi9a3 (6oi9 A:331-447)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:696406] [372364] (1 PDB entry)

8. Domain d6oi9a3: 6oi9 A:331-447 [372365]
   Other proteins in same PDB: d6oi9a1, d6oi9a2, d6oi9b1, d6oi9b2
   automated match to d2w6za3
   complexed with edo, mqm

Details for d6oi9a3

PDB Entry: 6oi9, 2.06 Å

PDB Description: crystal structure of e. coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d6oi9a3:

Sequence; same for both SEQRES and ATOM records:

>d6oi9a3 b.84.2.0 (A:331-447) automated matches {Escherichia coli [TaxId: 696406]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

Timeline for d6oi9a3:

• d6oi9a3 first appeared in SCOPe 2.07