Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (9 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (7 PDB entries) Coagulation factor XIII |
Domain d1fieb4: 1fie B:191-515 [37110] Other proteins in same PDB: d1fiea1, d1fiea2, d1fiea3, d1fieb1, d1fieb2, d1fieb3 |
PDB Entry: 1fie (more details), 2.5 Å
SCOP Domain Sequences for d1fieb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fieb4 d.3.1.4 (B:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmygakkplntegvmksr
Timeline for d1fieb4:
View in 3D Domains from other chains: (mouse over for more information) d1fiea1, d1fiea2, d1fiea3, d1fiea4 |