Lineage for d1fiea4 (1fie A:191-515)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 252917Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 252918Superfamily d.3.1: Cysteine proteinases [54001] (9 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 253103Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 253104Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 253105Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (7 PDB entries)
    Coagulation factor XIII
  8. 253112Domain d1fiea4: 1fie A:191-515 [37109]
    Other proteins in same PDB: d1fiea1, d1fiea2, d1fiea3, d1fieb1, d1fieb2, d1fieb3

Details for d1fiea4

PDB Entry: 1fie (more details), 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fiea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiea4 d.3.1.4 (A:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegvmksr

SCOP Domain Coordinates for d1fiea4:

Click to download the PDB-style file with coordinates for d1fiea4.
(The format of our PDB-style files is described here.)

Timeline for d1fiea4: