Lineage for d6hf7c_ (6hf7 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865737Species Methanococcus thermolithotrophicus [TaxId:2186] [89661] (2 PDB entries)
  8. 2865740Domain d6hf7c_: 6hf7 C: [370125]
    automated match to d1ki9a_
    complexed with 7mt, gol, mg, tb

Details for d6hf7c_

PDB Entry: 6hf7 (more details), 1.96 Å

PDB Description: crystal structure of the adenylate kinase from methanothermococcus thermolithotrophicus co-crystallized with tb-xo4
PDB Compounds: (C:) adenylate kinase

SCOPe Domain Sequences for d6hf7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hf7c_ c.37.1.1 (C:) Adenylate kinase {Methanococcus thermolithotrophicus [TaxId: 2186]}
knklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmrk
ldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiivv
etsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnlld
yaveelisvlr

SCOPe Domain Coordinates for d6hf7c_:

Click to download the PDB-style file with coordinates for d6hf7c_.
(The format of our PDB-style files is described here.)

Timeline for d6hf7c_: